Product Description
| Cat Number | PP-200 |
|---|---|
| Category | Peptide |
| Pack Size | 1 mg |
| Description | Autophagy inducing peptide |
| Modification | None |
| Purity | >95% by hplc |
| Biomarker Target | Protein-protein interactions,Antivirals |
| Sequence Three Letter Code | H-Tyr-Gly-Arg-Lys-Lys-Arg-Arg-Gln-Arg-Arg-Arg-Gly-Gly-Thr-Asn-Val-Phe-Asn-Ala-Thr-Phe-Glu-Ile-Trp-His-Asp-Gly-Glu-Phe-Gly-Thr-OH |
| Molecular Formula | C164H251N57O45 |
| Sl Sequence | YGRKKRRQRRRGGTNVFNATFEIWHDGEFGT |
| Solubility | Soluble in water |
| Appearance | Freeze dried solid |
| Storage | Store dry, frozen and in the dark |
| References |
Shoji-Kawata et al (2013) Identification of a candidate therapeutic autophagy-inducing peptide. Nature 494(7436) 201 PMID: 23364696Maejima (2016) Regulation of autophagy by Beclin 1 in the heart. J Mol Cell Cardiol 95 19 PMID: 26546165Wong (2019) Intestinal epithelial tight junction barrier regulation by autophagy-related protein ATG6/beclin 1. Am J Physiol Cell Physiol. 316(5) C753 PMID: 30892937 Related areasAll cell penetrating peptides >All protein-protein modulators >All antivirals >All regulated cell death categories > |
| Note | The product is for research use only |
Share Item: