Product Description
| Cat Number | PN-120 |
|---|---|
| Category | Peptide |
| Pack Size | 1 mg |
| Description | Stabilizes the transient receptor potential cation channel 1 (TRPA1) in an active state |
| Modification | Disulphide bridges between cysteine 9 and cysteine 27 and cysteine 13 and cysteine 23 |
| Purity | >95% by HPLC |
| Biomarker Target | Transient receptor potential (TRP) channels |
| Sequence Three Letter Code | H-Ala-Ser-Pro-Gln-Gln-Ala-Lys-Tyr-Cys-Tyr-Glu-Gln-Cys-Asn-Val-Asn-Lys-Val-Pro-Phe-Asp-Gln-Cys-Tyr-Gln-Met-Cys-Ser-Pro-Leu-Glu-Arg-Ser-OH (disulphide bridge between C9 and C27 and C13 and C23) |
| Molecular Formula | C164H245N45O53S5 |
| Sl Sequence | ASPQQAKYCYEQCNVNKVPFDQCYQMCSPLERS |
| Solubility | Soluble in DMSO as stock. |
| Appearance | Freeze dried solid |
| Storage | Storage desiccated, frozen and in the dark |
| References |
Lin King et al (2019) A Cell-Penetrating Scorpion Toxin Enables Mode-Specific Modulation of TRPA1 and Pain Cell 178(6) 1362 PMID: 31447178 Related areasAll peptides >All transient receptor potential channel modulators >All pain research categories > |
| Note | The product is for research use only |
Share Item: