Product Description
| Cat Number | GH-120 |
|---|---|
| Category | Peptide |
| Pack Size | 1 mg |
| Description | Neuropeptide Y2 receptor agonist |
| Modification | C terminal amide |
| Purity | >95% by HPLC |
| Biomarker Target | Neuropeptide Y receptors |
| Sequence Three Letter Code | H-Ile-Lys-Pro-Glu-Ala-Pro-Gly-Glu-Asp-Ala-Ser-Pro-Glu-Glu-Leu-Asn-Arg-Tyr-Tyr-Ala-Ser-Leu-Arg-His-Tyr-Leu-Asn-Leu-Val-Thr-Arg-Gln-Arg-Tyr-NH2 |
| Molecular Formula | C180H279N53O54 |
| Sl Sequence | IKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2 |
| Solubility | Soluble in dilute acid |
| Appearance | Freeze dried solid |
| Storage | Store dry, dark and frozen |
| References |
Batterham et al (2002) Gut hormone PYY3-36 physiologically inhibits food intake. Nature 418 650 PMID: 12167864Nonaka et al (2003) Characterization of blood-brain barrier permeability to PYY3-36 in the mouse. J.Pharmacol.Exp.Ther. 306 948 PMID: 12750431Torang et al (2015) The anorexic hormone Peptide YY3-36 is rapidly metabolized_x000D_
to inactive Peptide YY3-34 in vivo. Physiol. Rep. 3(7) e12455 PMID: 26197931 Related areas_x000D_ All peptides >All neuropeptide Y receptor modulators >All appetite regulation research categories > |
| Note | The product is for research use only |
Share Item: