Product Description
| Cat Number | GH-110 |
|---|---|
| Category | Peptide |
| Pack Size | 1 mg |
| Description | Neuropeptide Y agonist that binds all subtypes with similar affinity |
| Modification | C terminal amide |
| Purity | >95% by HPLC |
| Biomarker Target | Neuropeptide Y receptors |
| Sequence Three Letter Code | H-Tyr-Pro-Ile-Lys-Pro-Glu-Ala-Pro-Gly-Glu-Asp-Ala-Ser-Pro-Glu-Glu-Leu-Asn-Arg-Tyr-Tyr-Ala-Ser-Leu-Arg-His-Tyr-Leu-Asn-Leu-Val-Thr-Arg-Gln-Arg-Tyr-NH2 |
| Molecular Formula | C194H295N55O57 |
| Sl Sequence | YPIKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2 |
| Solubility | Soluble in dilute acid |
| Appearance | Freeze dried solid |
| Storage | Store desiccated, frozen and in the dark |
| References |
Tatemoto and Mutt (1980) Isolation of two novel candidate hormones using a chemical method for finding naturally occurring polypeptides. Nature 285(5764) 417 PMID: 6892950Karra et al (2009) The role of peptide YY in appetite regulation and obesity. J Physiol. 587(1) 19 PMID: 19064614Holzer et al (2012) Neuropeptide Y, peptide YY and pancreatic polypeptide in the gut-brain axis. Neuropeptides 46(6) 261 PMID: 22979996 Related areas All peptides >All neuropeptide Y receptor modulators >All appetite regulation research categories >All endocrinology research categories >All diabetes research categories > |
| Note | The product is for research use only |
Share Item: