Product Description
| Cat Number | GH-030 |
|---|---|
| Category | Peptide |
| Pack Size | 1 mg |
| Description | Proglucagon (72-107) proteolysis product |
| Modification | C terminal amide |
| Purity | >95% by HPLC |
| Biomarker Target | Glucagon and related receptors |
| Sequence Three Letter Code | H-His-Asp-Glu-Phe-Glu-Arg-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-NH2 |
| Molecular Formula | C184H273N51O57 |
| Sl Sequence | HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2 |
| Solubility | Soluble in dilute acid |
| Appearance | Freeze dried solid |
| Storage | Store desiccated, frozen and in the dark |
| References |
Schmidtler et al (1991) GLP-1-(7-36) amide, -(1-37), and -(1-36) amide: potent cAMP-dependent stimuli of rat parietal cell function. Am. J. Phys. Gast. Liver Physiol. 260(6) G940 PMID: 1711782Koole et al (2013) Recent advances in understanding GLP-1R (glucagon-like peptide-1 receptor) function. Biochem. Soc. Trans. 41(1) 172 PMID: 23356279 Related areas_x000D_ All peptides >All glucagon and related receptor modulators >All endocrinology research categories > |
| Note | The product is for research use only |
Share Item: