Product Description
| Cat Number | GH-040 |
|---|---|
| Category | Peptide |
| Pack Size | 1 mg |
| Description | Major metabolite of glucagon like peptide GLP-1 (7-36) amide |
| Modification | C terminal amide |
| Purity | >95% by HPLC |
| Biomarker Target | Glucagon and related receptors |
| Sequence Three Letter Code | H-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-NH2 |
| Molecular Formula | C140H214N36O43 |
| Sl Sequence | EGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2 |
| Solubility | Soluble in dilute acid |
| Appearance | Freeze dried solid |
| Storage | Store dry, frozen and desiccated |
| References |
Knudsen and Pridal (1996) Glucagon-like peptide-1-(9-36) amide is a major metabolite of glucagon-like peptide-1-(7-36) amide after in vivo administration to dogs, and it acts as an antagonist on the pancreatic receptor. Eur. J. Pharmacol. 318(2-3) 429 PMID: 9016935Elahi et al (2008) GLP-1 (9-36) amide, cleavage product of GLP-1 (7-36) amide, is a glucoregulatory peptide. Obesity 16(7) 1501 PMID: 18421270Sathananthan et al (2013) Direct Effects of Exendin-(9,39) and GLP-1-(9,36)amide on Insulin Action, β-Cell Function, and Glucose Metabolism in Nondiabetic Subjects. Diabetes 62(8) 2752 PMID: 23545708 Related areasAll peptides >All glucagon and related receptor modulators >All endocrinology research categories >All diabetes research categories > |
| Note | The product is for research use only |
Share Item: