Recombinant Chandipura Virus Glycoprotein G (Partial) for Virology and Vaccine Research|BTL Biotechno Labs Pvt Ltd

The Recombinant Chandipura Virus Glycoprotein G (Partial) is a valuable research reagent designed to support studies on viral pathogenesis, host-virus interactions, immune responses, and diagnostic assay development. As the major surface glycoprotein of Chandipura virus, Glycoprotein G plays a critical role in viral attachment and membrane fusion, making it an important target for virology research.

Key Features

• Recombinant Chandipura Virus Glycoprotein G (Partial).
• Expressed in an E. coli expression system.
• Covers amino acid region 22–473 of the glycoprotein.
• Approximate molecular weight: 58 kDa.
• Purity of ≥85%, as determined by SDS-PAGE.
• Available in liquid or lyophilized formats.
• Suitable for Research Use Only (RUO).
• Features an N-terminal 10×His tag and C-terminal Myc tag for simplified detection and purification.

Applications

• Viral entry and membrane fusion studies
• Host-pathogen interaction research
• Antibody generation and characterization
• Immunological and serological assay development
• Diagnostic assay validation
• Vaccine antigen evaluation
• Structural and functional protein studies

Why Study Chandipura Virus Glycoprotein G?

• Mediates viral attachment to host cell receptors.
• Facilitates endocytosis and membrane fusion during infection.
• Serves as a key antigen for immune response studies.
• Supports the development of vaccines, therapeutics, and diagnostic assays targeting Chandipura virus.

Complete Sequence: 

YLSIAFPENTKLDWKPVTKNTRYCPMGGEWFLEPGLQEESFLSSTPIGATPSK SDGFLCHAAKWVTTCDFRWYGPKYITHSIHNIKPTRSDCDTALASYKSGTLVSL GFPPESCGYASVTDSEFLVIMITPHHVGVDDYRGHWVDPLFVGGECDQSYCD TIHNSSVWIPADQTKKNICGQSFTPLTVTVAYDKTKEIAAGGIVFKSKYHSHME GARTCRLSYCGRNGIKFPNGEWVSLDVKTRIQEKHLLPLFKECPAGTEVRSTL QSDGAQVLTSEIQRILDYSLCQNTWDKVERKEPLSPLDLSYLASKSPGKGLAY TVINGTLSFAHTRYVRMWIDGPVLKEPKGKRESPSGISSDIWTQWFKYGDMEI GPNGLLKTAGGYKFPWHLIGMGIVDNELHELSEANPLDHPQLPHAQSIADDSE EIFFGDTGVSKNPVELVTGWFTSWKE

BTL Biotechno Labs Pvt. Ltd. is a leading supplier/distributor of Chandipura virus recombinant proteins, antibodies, ELISA kits, and other virology research products in India. We support universities, research institutes, biotechnology companies, pharmaceutical organizations, and diagnostic laboratories with high-quality research reagents for infectious disease and viral immunology research.

For product details, please connect with us at info@biotechnolabs.com.